- Recombinant Human Transmembrane protein 150B (TMEM150B)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1064661
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 25,701 Da
- E Coli or Yeast
- Transmembrane protein 150B (TMEM150B)
- 28-233
- transmembrane protein 150B
- TMEM224
Sequence
VTNRTVDLSKGFPYISICGSFPPQSCIFSQVLNMGAALAAWICIVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGAFLAFILGNVYFWLQLLLWRLKRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSVSAACEWVVAMLLFALFGLLAVDFSALESCTLCVQPWPSLSPPPASPISLPVQL